CRAMP (mouse) trifluoroacetate salt,CAS : 376364-36-2
H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-806 | 1mg | 180.00 | + Add to cart |
|
R-M-806 | 5mg | 740.00 | + Add to cart |
|
|
Product description
CRAMP is a cathelin-related antimicrobial peptide expressed in the embryonic and adult mouse. Functional studies showed CRAMP to be a potent antibiotic against Gram-negative bacteria by inhibiting growth of a variety of bacterial strains and by permeabilizing the inner membrane of E.coli directly.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 376364-36-2 |
Sequence | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
Molecular Formula | C₁₇₈H₃₀₂N₅₀O₄₆ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product